PFA0705c	Andrew Berry	25-Feb-05	STEVOR pseudogene putative, MAL1P4.16e	 gene model modified coordinates changed from (562196..563256) to (562299..563256)
PFA0755w	Andrew Berry	25-Feb-04	VAR pseudogene, erythrocyte membrane protein 1 (PfEMP1) pseudogene	 gene model modified coordinates changed to (602412 .. 602844) from (602409 .. 603712)
PFA0075w	Andrew Berry	25-Apr-04	VAR pseudogene, erythrocyte membrane protein 1 (PfEMP1) pseudogene, MAL1P1.6	 gene model modified coordinates chnaged from (78474..80126) to (79215..79452) on the basis of similarity evidence
PFA0695c	Andrew Berry	25-Feb-04	VAR-like pseudogene, erythrocyte membrane protein 1 (PfEMP1)-like, pseudogene, MAL1P4.16c	 gene model modified changed from coordinates (555602 ..556651) to (555770..556651)
PFB0177c	Andrew Berry	11-Apr-05	hypothetical protein, 1400.t00202, PF02_0036	 gene model modified gene models PFB0176c and PFB0177c joined. PFB0177c retained as unique identifier.
PFB0790c	Andrew Berry	08-Dec-04	hypothetical protein, 1400.t00075, PF02_0160	 gene model modified after TBLASTX comparison with P. knowlesi
PFB0885w	Andrew Berry	11-Nov-04	40S ribosomal protein S30, putative, 1400.t00055, PF02_0179	 gene model modified
PFB0260w	Andrew Berry	11-Apr-05	proteasome 26S regulatory subunit, putative, 1400.t00181, PF02_0055	gene model modified, exon I extended
PFB0925w	Andrew Berry	10-Dec-04	hypothetical protein, PF02_0191, obsolete:1400.t00043	 gene model modified coordinates of exon 3 modified
PFC0820w	Andrew Berry	12-Nov-05	hypothetical protein, MAL3P6.23	 gene model modified on the basis of comparison of regions of conserved synteny with P. knowlesi and P. vivax. Eleven amino acids removed from the predicted protein sequence in the N- terminal region
PFC0825c	Andrew Berry	11-Nov-04	cleavage and polyadenylation specificity factor protein, putative, MAL3P6.24	 gene model modified intron added to gene model
PFD0400w	Andrew Berry	12-Nov-04	hypothetical protein, MAL4P2.17	 gene model modified intron defined after MET246 resulting in the loss of 29 amino from the predicted protein sequence
PFD0669c	Andrew Berry	11-Nov-04	hypothetical protein, MAL4P1.133b	 gene model modified exon 4 added on the basis of comparison of conserved synteny to P. knowlesi and P. yoelii and as predicted using SNAP prediction algorithm
PFD0850c	Andrew Berry	11-Nov-04	hypothetical protein, conserved, MAL4P1.165, obsolete:PFD0825c	 gene model modified Coordinates of exon 2 changed on the basis of comparison of region of conserved synteny with P. knowlesi and P.yoelii
PFD0860w	Andrew Berry	11-Nov-04	hypothetical protein, MAL4P1.167	 gene model modified on the basis of comparison of regions of conserved synteny with P. knowlesi and P yoelii and using the SNAP prediction algorithm
PFE0405c	Andrew Berry	12-Nov-04	hypothetical protein, MAL5P1.83	 gene model modified Intron defined in exon2.
PFE1300w	Andrew Berry	12-Nov-04	hypothetical protein, MAL5P1.260	 gene model modified intron defined after PHE317 resulting in the loss of 83 amino acids form the predicted protein sequence.
PFE1305c	Andrew Berry	11-Nov-04	hypothetical protein, MAL5P1.261	 gene model modified defined on the basis of comparison with P knowlesi and P yoelii. Four new 5' exons defined.
PFE1425c	Andrew Berry	12-Nov-04	hypothetical protein, MAL5P1.283	 gene model modified coordinates of exon1 and 2 redefined on the basis of SNAP gene prediction and the comparison of exon structure in this region with P. knowlesi and P. yoelii
PFE1440c	Andrew Berry	13-Nov-04	hypothetical protein, MAL5P1.286, obsolete:PFE1430c	 gene model modified on the basis of SNAP prediction
PFF0600w	Andrew Berry	30-Mar-05	hypothetical protein, MAL6P1.302, obsolete:2270.t00017	gene model modified
MAL7P1.127	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL7P1.128	 gene model modified MALP1.128 incorporated into the terminal exon of MALP1.127
MAL7P1.146	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL7P1.146	 gene model modified two amino acids differ from the previous predicted protein sequence ILE1006 was ARG1006 LEU 1008 was VAL1008
MAL7P1.16	Andrew Berry	20-Dec-04	hypothetical protein	 gene model modified
MAL7P1.186	Andrew Berry	14-Apr-05	VAR-like erythrocyte membrane protein 1, MAL7P1.211	 gene model modified coordinates of exon 1 modified to give more plausible donor site
MAL7P1.82	Andrew Berry	17-Jan-05	hypothetilcal protein, 	 gene model modified
PF07_0095	Andrew Berry	14-Nov-04	hypothetical protein, conserved	gene model modified, exon I truncated and exon 2 and 3 defined.
PF07_0053	Andrew Berry	17-Jan-05	hypothetical protein	gene model modified in updated sequence assemly which resulted in the change of four amino acids. LYS88 formerly ARG88, ASN99 formerly ASP99, ILE97 formerly MET97, TYR121 formerly PHE121
PF07_0120	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on remapping onto new sequence assembly. Results in the insertion of 11 amino acids. Current sequence 1492NNINNNNNNNNNNNYYDRTNDGNFSNGK1520 previously 1492IILIIIIIIIIIIITMI
MAL8P1.1	Andrew Berry	30-Nov-04	hypothetical protein, conserved in 	gene model modified C-terminal end of the protein extended by 600 amino acids
MAL8P1.104	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL8P1.104	 gene model modified on remapping onto new assembly resulting in the change of 1 amino acid in the predicted protein sequence ASP1777 formerly ALA1777.
MAL8P1.11	Andrew Berry	15-Nov-04	hypothetical protein	 Gene model modified intron added in exon2;exon 3 added. 
MAL8P1.134	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on comparison to regions of conserved synteny in P. yoelli and P. knowlesi. The terminal exon modified resulting in a change of the carboxy terminus (..MDCSGCYRNWDIFPHIFV) formerly (VWIVGGVIVIGIFFLIF)	
MAL8P1.148	Andrew Berry	14-Dec-04	hypothetical protein, obsolete:MAL8P1.148	 gene model modified 5' end of exon 1 modified on remapping. N terminus now MNNQKRYEYWPLEEIILPKKIQNVQFCED..formerly MSNFVKN..	
MAL8P1.150	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on the basis of comparison of regions of conserved synteny with with P. knowlesi and P. yoelii and using the SNAP gene prediction algorithm. Resulted in 78 amino acids removed from the predicted protein sequence (YTNMKKTKMINIIMKTMMSSIRLSTQGRIMRRIMRRIMRRIMRRIMRRIMNRIMRRIM NRIMRRIMNRIMKEMN)	
MAL8P1.154	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:PF08_0133	 gene model modified upon remapping onto new sequence assembly. Due to a abolotion of a stop codon in the remapped sequence PF08_0133 now part of a single orf with MAL8P1.154. The presence or absence of introns in this highly repetative sequence cannot be ruled out	
MAL8P1.155	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL8P1.155	 gene model modified when remapped to new sequence assembly. Two amino acids in the differ from the previous sequence, ILE161 was LYS161, LEU162 was MET162	
MAL8P1.29	Andrew Berry	15-Nov-04	hypothetical protein, obsolete:MAL8P1.29	 gene model modified exon 2 added on the basis of synteny with P knowlesi and P. yoelii. Note this gene model may not be in PlasmoDB but will be added in the next scheduled update	
MAL8P1.47	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL8P1.47	 gene model modified Exon3 truncated resulting in the loss of 18 amino acids from the predicted protein sequence	
MAL8P1.49	Andrew Berry	15-Dec-04	hypothetical protein	 gene model modified Intron defined in former exon1 resulting in the loss of 106 amino acids from the predicted protein sequence	
MAL8P1.63	Andrew Berry	15-Dec-04	hypothetical protein, conserved, obsolete:MAL8P1.63	 gene model modified after SNAP gene prediction analysis. Exon 6 truncated (VNSDLIK),exons 7,8 and the interstitial region fused resulting in addition of 7 aa (VYSEVIFCSAFEQ); exon12 truncated by 43 aa VREKIKKIKKINEYIYIYKYIYTYFYFYLYFSMVTNLSGLLFI)	 exons 13 and 14 added
MAL8P1.66	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL8P1.66	 gene model modified on the basis of comparison of exon organisation between P. falciparum, P. knowlesi, and P. yoelii with the aid of the SNAP gene prediction algorithm resulting in the loss of 26 amino acids from the predicted protein sequence	
MAL8P1.71	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL8P1.71	 gene model modified upon remapping onto new assembly resulting in change to 1 amino acid in the predicted protein sequence ARG366 formerly ILE366	
MAL8P1.73	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL8P1.73	 gene model modified on the basis of the SNAP gene prediction algorithm and comparison on regions of conserved synteny between P. falciparum, P. knowlesi, and P. yoelii	
MAL8P1.76	Andrew Berry	14-Apr-05	meiotic recombination protein dmc1-like protein, obsolete:MAL8P1.76	 gene model modified coordinates of exon 3 modified after an incorrect splice site in the previous model was identified	
MAL8P1.80	Andrew Berry	21-Dec-04	hypothetical protein	 gene model modified on the basis of comparison on regions of conserved synteny between P. falciparum, P. yoelii and P. knowlesi and with the aid of the SNAP gene prediction algorithm. Resulting in the loss one exon and 52 amino acids from the gene model.	
MAL8P1.93	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL8P1.93	 gene model modified Resulting addition of 1 amino acid residue (PHE94) on remapping of the gene model onto the new assembly	
MAL8P1.99	Andrew Berry	17-Jan-05	hypothetical protein, obsolete:MAL8P1.99	 gene model modified Exon/intron boundary modified between exon1 and exon2 resulting in the loss of 21 aa from the predicted protein sequence (GYHLVYIYIYIYIYVNKFLFI). Modified on the basis of comparison to regions of conserved synteny in P. falciparum	 P. knowlesi and P. yoelii and with the aid of the SNAP gene prediction algorithm
PF08_0081	Andrew Berry	20-Dec-04	hypothetical protein	gene model modified  exon 1 added after remapping, N terminus now MEYFFYLLKFLC.., formerly M..	
PF08_0102	Andrew Berry	17-Jan-05	pfa55-14, asparagine-rich antigen Pfa55-14	 gene model modified on remapping onto new assembly resulting in the change of one amino acid in the predicted protein sequence	 THR1174 formerly ALA1174
PFI0155c	Andrew Berry	30-Mar-05	ras family GTP-ase, putative	 gene model modified after TBLASTX comparison with P. knowlesi. Exon 1 and 2 defined, exon II on the basis of comparison to knowlesi. Previous coordinates 133761..133830,133929..134077,134203..134277,134402..134548,134705..134803	
PFI0410c	Andrew Berry	15-Nov-04	hypothetical protein	 gene model modified reviewed in the light of the prediction from the SNAP algorithm	
PFI0850w	Andrew Berry	29-Nov-04	hypothetical protein	 gene model modified resulting in 27 amino acids removed from the predicted protein (SKKKKKLKKNNKMHKKNKKKLKNLYKK)	
PFI0985c	Andrew Berry	15-Apr-05	chaperone protein	 gene model modified after TBLASTX comparison to P. knowlesi	
PFI1095w	Andrew Berry	15-Apr-05	hypothetical protein	 gene model modified after TBLASTX comparison with P. knowlesi	
PFI1315c	Andrew Berry	29-Nov-04	hypothetical protein	 gene model modified intron defined after N93	 381 amino acids removed from previous predicted protein as a result
PFI1345c	Andrew Berry	15-Apr-05	hypothetical protein	 gene model modified after TBLASTX comparison with P. knowlesi	
PFI1350c	Andrew Berry	12-Nov-05	hypothetical protein	 gene model modified Location of intron splice donor and acceptor sites revised resulting in a loss of 27 amino acids from the predicted protein sequence	
PFI1435w	Andrew Berry	15-Apr-05	RNA binding function, putative	 gene model modified after TBLASTX comparison to P. knowlesi. Exons 1 and 2 defined	
PFI1460c	Andrew Berry	15-Apr-05	hypothetical protein	 gene model modified after TBLASTX comparison with P. knowlesi	
PF10_0188	Andrew Berry	04-Apr-05	hypothetical protein, 1398.t00241	 gene model modified after TBLASTX comparison with P knowlesi	
PF10_0371	Andrew Berry	14-Apr-05	hypothetical protein, 1398.t00055	 gene model modified after TBLASTX comparison with P. knowlesi	
PF10_0359	Andrew Berry	14-Apr-05	hypothetical protein, 1398.t00067	 gene model modified after TBLASTX comparison with P. knowlesi	
PFL2580w	Andrew Berry	11-Apr-05	hypothetical protein, 2277.t00514, MAL12P1.511	gene model modified, identified as a RIFIN pseudogene	
PFL0705c	Andrew Berry	07-Apr-05	adrenodoxin-type ferredoxin, putative, 2277.t00142, MAL12P1.141	gene model modified, exons 1 and 2 defined after comparison with P. knowlesi
MAL13P1.145	Andrew Berry	18-Jan-05	hypothetical protein	 gene model modified on remapping onto new sequence assembly resulting in a change of 2 amino acids in the predicted protein sequence LYS2067 formerly ASN2069 and 2069LYS formerly ASN2069
MAL13P1.155	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on remaping onto new sequence assembly resulting in a change of one amino acid in the predicted protein sequence,THR1133 formerly PRO1133
MAL13P1.176	Andrew Berry	18-Jan-05	Plasmodium falciparum reticulocyte binding protein 2 homolog b	 gene model modified The N-terminus bas been extended by 2064 amino acids
MAL13P1.189	Andrew Berry	17-Jan-05	conserved hypothetical protein	 gene model modified based on a manualy reviewed SNAP prediction. This resulted in the definition of five additional exons
MAL13P1.195	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on the basis of a manually reviewed SNAP prediction. The 5' end of exon five has been extended and the N-terminal region modified
MAL13P1.205	Andrew Berry	20-Aug-04	GTP-binding protein, putative	 gene model modified with the aid of SNAP gene prediction and comparison to regions of conserved synteny in knowlesi and yoelii. This results in a loss of 25 amino acids The N-terminal region is now MISHICIKNHHITCGIIKFPFIIFNFFDINFYSYLRS was formerly MSNEEYDHLYKIILVGDATVGK. The carboxy terminus has also been modified is now ..FLFRFFFFLQYYYY was formerly ..VKCC
MAL13P1.209	Andrew Berry	17-Jan-05	60S ribosomal subunit porotein L18, putative	 gene model modified on the basis of a manually reviewed SNAP gene prediction. Exon1 redefined resulting in a change in the N-terminus is now MY.., was formerly MKYLMNH..
MAL13P1.231	Andrew Berry	17-Jan-05	pfsec61, Pfsec61, PF13_0244, PF13_0244	 gene model modified on remapping onto new assembly resulting in loss of 12 amino acids (MVRFLNLIKPV) from the N terminus of the predicted protein sequence.
MAL13P1.255	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified in remapping onto new sequence assembly resulting in the addition of 35 amino acids to the predicted protein sequence DSDHNNENINKKDSDHNNDTINKKYSDHNNDSINKK
MAL13P1.267	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified upon remapping onto new sequence assembly  and  revised after TBLASTX comparison with P. knowlesi
MAL13P1.272	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on remapping onto new sequence assembly resulting in change to two amino acids
MAL13P1.286	Andrew Berry	17-Jan-05	hypothetical protein, PF13_0311	 gene model modified on remapping onto new sequence assembly resulting in addition of 33 amino acids to the predicted amino acid sequence. Previously two introns were defined in what is now a single intron
MAL13P1.295	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on remapping onto new sequence assembly resulting in 25 amino acids being removed from the predicted protein sequence
MAL13P1.296	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on remapping onto new sequence assembly resulting in addition of 124 amino acids to the predicted protein sequence. Previously the gene model was incomplete in that no start or stop codon was defined
MAL13P1.310	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on reampping onto new sequence assembly. 18 amino acids added to the N-termins of the predicted protein sequence which is now MGCINSKVKEKRKIKKRKKEECNLI.. was formerly MGKNVIKE..
MAL13P1.313	Andrew Berry	17-Jan-05	hypothetical protein, PF13_0332	 gene model modified on remapping onto new sequence assembly resulting in 18 amino acids being added to the predicted protein sequence. Note that the prediction of introns in this gene model is made very difficult to the highly repetetive nature of the sequence	
MAL13P1.6	Andrew Berry	18-Jan-05	VAR-like, erythrocyte membrane protein 1-like	 gene model modified upon remapping onto a new sequence assembly resulting in a loss of 169 aa from the predicted protein sequence.	
MAL13P1.71	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on remapping resulting in addition of 193 amino acids ot the predicted protein sequence	
MAL13P1.78	Andrew Berry	18-Jan-05	hypothetical protein	 gene model modified N-terminus redefined resulting in a loss of 13 amino acids from the predicted protein sequence. M-terminus formerly MILYNILYYIILYVFIYYYV.., now MCLYIIMY	
PF13_0210	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on remapping onto new sequence assembly resulting in 77 amino acids being aded to the predicted protein sequence	
PF13_0235	Andrew Berry	17-Jan-05	hypothetical protein	 gene model modified on remapping onto new sequence assembly resulting in the loss of 10 amino acids from the predicted protein sequence	 
PF14_0138	Andrew Berry	05-Apr-05	hypothetical protein, 1396.t00644	gene model modified intron inserted after TBLASTX comparison with P. knowlesi, Exon IV (554268..554349)	
PF14_0435	Andrew Berry	04-Apr-05	hypothetical protein, 1396.t00347	gene model modified exons 2 and 3 defined after TBLASTX comparison with P. knowlesi	
PF14_0680	Andrew Berry	15-Apr-05	hypothetical protein, 1396.t00096	 gene model modified after TBLASTX comparison to P. knowlesi. Exons 3 and 4 defined. Formerly a 2 exon gene model	
PF14_0653	Andrew Berry	15-Apr-05	hypothetical protein, 1396.t00122	 gene model modified exonI added and exon 2 (formerly exon 1) extended at the N-terminus	
PF14_0595	Andrew Berry	07-Apr-05	hypothetical protein, 1396.t00185	 gene model modified after check of splice donor and acceptor sites. ExonI added. Confirmed by FASTA searches against UNIPROT	
PF14_0488	Andrew Berry	05-Apr-05	hypothetical protein, 1396.t00293	 gene model modified after TBLASTX comparison to P. knowlesi. Exons 7,8 and 9 defined. Was formerly a 6 exon gene model	
PF14_0460	Andrew Berry	15-Apr-05	hypothetical protein, 1396.t00322	 gene model modified after TBLASTX comparison with P. knowlesi. Exons 3, 4, and 5 defined. These bridge and thus caused to fuse genes PF14_0459 and PF14_0460. Exon 6 was formerly exon 1 of PF14_0459. Exons 8 and 9 newly defined	
PF14_0403	Andrew Berry	04-Apr-05	protein prenyltransferase alpha subunit, putative, 1396.t00379	 gene model modified exons added after TBLASTX comparison with P. knowlesi. Exons 4 to 8 defined. Intron defined in Exon 3	
PF14_0376	Andrew Berry	04-Apr-05	hypothetical protein, 1396.t00406	 gene model modified after TBLASTX comparison with P. knowlesi. Exons I and II defined. Former exon I truncated by 25 aa	
PF14_0229	Andrew Berry	06-Apr-05	hypothetical protein, 1396.t00553	 gene model modified exon III defined after TBLASTX comparison with P. knowlesi.	
PF14_0178	Andrew Berry	16-Apr-05	hypothetical protein, 1396.t00605	 gene model modified after TBLASTX comparison with P. knowlesi. Exons 1,2 and 3 added. Gene model formerly a 5 exon model